Your home of Turok 2: Seeds Of Evil Codes and Turok 2: Seeds Of Evil Hints
Turok 2: Seeds Of Evil Cheats
Cheat Codes > Game Boy Cheats > Turok 2: Seeds Of Evil Cheat Codes

Turok 2: Seeds Of Evil Cheats

Game Boy

All Weapons
Enter "DLVTRKBWPS" as a password.
Alternate End Sequence
When the enemy appears in level 9, press Down. After entering the tunnel, shoot the computer and destroy the incubator. Then an alternate ending sequence will begin.
Bird Mode
Enter "DLVTRKBBRD" as a password. Then while playing game, hold Select and press A to fly.
Infinite Health
Enter "DLVTRKBNRG" as a password.
Infinite Lives
Enter "DLVTRKBLVS" as a password.
Level Passwords
LevelEasyMediumHard
2DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
3GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
4DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
5GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
6DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
7GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
8DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
9GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD
Level Select
Enter "DLVTRKBLVL" as a password.
Powerful Weapons
Enter "QVZLBVSQLV" as a password and play the game on the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin a new game on the easy difficulty setting, then intentionally lose all lives. Begin another new game on the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun.
Note: Collect the pistol on level 2 to get ammunition for the chain gun.


Gameshark Turok 2: Seeds Of Evil Hacks
Infinite Lives010AABC1
Infinite Health0163A9C1

Get Turok 2: Seeds Of Evil
Find a great deal on Turok 2: Seeds Of Evil at Amazon.com

Turok 2: Seeds Of Evil Strategy Guide
Get help with the Turok 2: Seeds Of Evil Strategy Guide at Amazon.com

© 2024 Total Cheats. All Rights Reserved.